Structure of PDB 6c0w Chain H Binding Site BS02

Receptor Information
>6c0w Chain H (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>6c0w Chain J (length=139) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatgtatatatctgacacgtgcctggagactagggagtaatccccttggc
ggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagc
tgtctacgaccaattgagcggcctcggcaccggattctc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0w Decoding the centromeric nucleosome through CENP-N.
Resolution4.0 Å
Binding residue
(original residue number in PDB)
Y42 I54 S55 S56 R86
Binding residue
(residue number reindexed from 1)
Y10 I22 S23 S24 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6c0w, PDBe:6c0w, PDBj:6c0w
PDBsum6c0w
PubMed29280735
UniProtP62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I (Gene Name=H2BC4)

[Back to BioLiP]