Structure of PDB 6bli Chain H Binding Site BS02

Receptor Information
>6bli Chain H (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPSSLSASVGDRVTITCRASQSIDNYLNWYQQKPGKAPKLLIYA
ASGLQSGVPSRFSGSGSGTEFTLTVSSLHPEDFATYYCQQSYSTLTWTFG
QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGE
Ligand information
>6bli Chain L (length=29) Species: 11256 (Human respiratory syncytial virus (strain RSB6256)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FHFEVFNFVPCSICSNNPTCWAICKRIPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bli Structural basis for recognition of the central conserved region of RSV G by neutralizing human antibodies.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		N31 A50 S52 G53 S65 G66
Binding residue
(residue number reindexed from 1)		N31 A50 S52 G53 S65 G66
External links