Structure of PDB 5xm0 Chain H Binding Site BS02

Receptor Information
>5xm0 Chain H (length=92) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAH
YNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>5xm0 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xm0 Histone H3.3 sub-variant H3mm7 is required for normal skeletal muscle regeneration.
Resolution2.874 Å
Binding residue
(original residue number in PDB)		S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)		S23 S24 R54 S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5xm0, PDBe:5xm0, PDBj:5xm0
PDBsum5xm0
PubMed29643389
UniProtQ9D2U9|H2B3A_MOUSE H2B.U histone 2 (Gene Name=H2bu2)

[Back to BioLiP]