Structure of PDB 5n9g Chain H Binding Site BS02

Receptor Information
>5n9g Chain H (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIE
IKNKFKREEKTNGWRIDKAFQEKRPFDFDFFAHLLQKVLAEEEKRKQK
Ligand information
>5n9g Chain J (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttgaagggcttaaaataggtgtgac
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n9g Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F294 S300 P302 N339 R343
Binding residue
(residue number reindexed from 1)		F8 S14 P16 N53 R57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5n9g, PDBe:5n9g, PDBj:5n9g
PDBsum5n9g
PubMed28743884
UniProtA6H8Y1|BDP1_HUMAN Transcription factor TFIIIB component B'' homolog (Gene Name=BDP1)

[Back to BioLiP]