Structure of PDB 5jre Chain H Binding Site BS02

Receptor Information

>5jre Chain H (length=185) Species: 228908 (Nanoarchaeum equitans Kin4-M) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSAD
KYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIP
SKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLY
LDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS

Ligand information

>5jre Chain J (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jre Structural basis for single-stranded RNA recognition and cleavage by C3PO
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Q20 V23 D24 S26 I27 S30 I78 E82
Binding residue (residue number reindexed from 1)	Q21 V24 D25 S27 I28 S31 I79 E83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5jre, PDBe:5jre, PDBj:5jre
PDBsum	5jre
PubMed	27596600
UniProt	Q74ML9

[Back to BioLiP]