Structure of PDB 5gmk Chain H Binding Site BS02

Receptor Information
>5gmk Chain H (length=95) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEWK
RQVSKEIKQKSTRIYDPSLNEMQIAELNDELNNLFKEWKRWQWHI
Ligand information
>5gmk Chain M (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuaagaacuagauacuaacacauuuuu
.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
Resolution3.4 Å
Binding residue
(original residue number in PDB)		S2 R36 N37 R91
Binding residue
(residue number reindexed from 1)		S1 R35 N36 R90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000389 mRNA 3'-splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0071020 post-spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gmk, PDBe:5gmk, PDBj:5gmk
PDBsum5gmk
PubMed27445308
UniProtP21374|ISY1_YEAST Pre-mRNA-splicing factor ISY1 (Gene Name=ISY1)

[Back to BioLiP]