Structure of PDB 5gm6 Chain H Binding Site BS02

Receptor Information

>5gm6 Chain H (length=151) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKK
EYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPEKSLKEASRARVQPKMG
ALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDH
K

Ligand information

>5gm6 Chain L (length=66) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
caguguaacaacugaa

................................................<<
<<<<......>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution	3.5 Å
Binding residue (original residue number in PDB)	W149 D153 Q177
Binding residue (residue number reindexed from 1)	W19 D23 Q47

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005686	U2 snRNP
GO:0071004	U2-type prespliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum	5gm6
PubMed	27445306
UniProt	Q02554\|CUS1_YEAST Cold sensitive U2 snRNA suppressor 1 (Gene Name=CUS1)

[Back to BioLiP]