Structure of PDB 5eft Chain H Binding Site BS02

Receptor Information
>5eft Chain H (length=255) Species: 566568 (Rice black-streaked dwarf virus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LERRTFGSYKIEELTIKKIPLLDDGIFELLNYLIDGTNFNKTCYCGFNYS
HLPNLERDFNIASLYVRENFEICTDQLDLANYVRQPNISIKSPDFTVCLE
YVLKTVVQETKFVEMSLLPLLNREEESLTEEILEGEGAVVNVLKLFIKGF
LMHLGENPNSYDRQLTVEKYRPLLVSIVGYEYLVGKINHIYYQLATFDNY
PFDLLRFQLSSLISTPTSILERITKEGLFKIITTVLFRGINGSESFLNIK
RYRRF
Ligand information
>5eft Chain G (length=16) Species: 566568 (Rice black-streaked dwarf virus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADSVIKSDFSSLKLDV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eft Structural Basis for Specific Recognition of ssDNA by SRBSDV P9-1 Octamers
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P79 K197 L198 K201 L204 M205 G208 P211 N212 N247 Y250 R265 L268
Binding residue
(residue number reindexed from 1)		P53 K144 L145 K148 L151 M152 G155 P158 N159 N188 Y191 R206 L209
Enzymatic activity
Enzyme Commision number ?
External links