Structure of PDB 4x23 Chain H Binding Site BS02

Receptor Information
>4x23 Chain H (length=90) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>4x23 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y39 G50 I51 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
Y8 G19 I20 S22 R52 S53 T54
Binding affinityPDBbind-CN: Kd=0.1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]