Structure of PDB 4qlc Chain H Binding Site BS02

Receptor Information
>4qlc Chain H (length=94) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>4qlc Chain J (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acttacatgcacaggatgtatatatctgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctccagggcggccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
Resolution3.503 Å
Binding residue
(original residue number in PDB)		K29 Y39 S52 S53 S84 T85
Binding residue
(residue number reindexed from 1)		K2 Y12 S25 S26 S57 T58
Binding affinityPDBbind-CN: Kd=0.35uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]