Structure of PDB 4ass Chain H Binding Site BS02

Receptor Information
>4ass Chain H (length=93) Species: 1428 (Bacillus thuringiensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKP
TVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ass Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems.
Resolution7.0 Å
Binding residue
(original residue number in PDB)		N42 K43 T44 K54 F58
Binding residue
(residue number reindexed from 1)		N37 K38 T39 K49 F53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0042802 identical protein binding
Biological Process
GO:0030541 plasmid partitioning

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ass, PDBe:4ass, PDBj:4ass
PDBsum4ass
PubMed23010931
UniProtQ8KNP2|TUBR_BACTI DNA-binding transcriptional repressor TubR (Gene Name=tubR)

[Back to BioLiP]