Structure of PDB 3wtu Chain H Binding Site BS02

Receptor Information
>3wtu Chain H (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wtu A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		P334 R391 R394 Y397 K404 R409
Binding residue
(residue number reindexed from 1)		P2 R59 R62 Y65 K72 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3wtu, PDBe:3wtu, PDBj:3wtu
PDBsum3wtu
PubMed25083921
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]