Structure of PDB 3lja Chain H Binding Site BS02

Receptor Information
>3lja Chain H (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>3lja Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lja Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
Resolution2.75 Å
Binding residue
(original residue number in PDB)
K25 R26 R27 T29 R30 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
K2 R3 R4 T6 R7 S29 S30 R60 S61 T62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3lja, PDBe:3lja, PDBj:3lja
PDBsum3lja
PubMed20350553
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]