Structure of PDB 3c1b Chain H Binding Site BS02

Receptor Information
>3c1b Chain H (length=94) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>3c1b Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c1b The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
K1428 T1429 S1452 S1453 R1483 S1484 T1485
Binding residue
(residue number reindexed from 1)
K1 T2 S25 S26 R56 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3c1b, PDBe:3c1b, PDBj:3c1b
PDBsum3c1b
PubMed18794842
UniProtQ28D68

[Back to BioLiP]