Structure of PDB 2irf Chain H Binding Site BS02

Receptor Information
>2irf Chain H (length=109) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPL
FRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
AFRVYRMLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2irf Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
R207 M208 W258 T262 K264 N280 C283 A284 L288
Binding residue
(residue number reindexed from 1)
R3 M4 W54 T58 K60 N76 C79 A80 L84
Binding affinityPDBbind-CN: Kd=0.17uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2irf, PDBe:2irf, PDBj:2irf
PDBsum2irf
PubMed10487755
UniProtP23906|IRF2_MOUSE Interferon regulatory factor 2 (Gene Name=Irf2)

[Back to BioLiP]