Structure of PDB 1ycp Chain H Binding Site BS02

Receptor Information
>1ycp Chain H (length=247) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRREVQPS
VLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGP
FVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ycp Crystal structure of fibrinogen-Aalpha peptide 1-23 (F8Y) bound to bovine thrombin explains why the mutation of Phe-8 to tyrosine strongly inhibits normal cleavage at Arg-16.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L41 H57 K97 E97A I174 D189 A190 C191 E192 G193 S195 S214 W215 G216 G219
Binding residue
(residue number reindexed from 1)		L27 H43 K93 E94 I171 D191 A192 C193 E194 G195 S197 S218 W219 G220 G222
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ycp, PDBe:1ycp, PDBj:1ycp
PDBsum1ycp
PubMed9307032
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]