Structure of PDB 1y19 Chain H Binding Site BS02

Receptor Information

>1y19 Chain H (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAG
FLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTY
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKR
WAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL

Ligand information

>1y19 Chain G (length=11) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SWVYSPLHYSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1y19 Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
Resolution	2.6 Å
Binding residue (original residue number in PDB)	P209 V210 Q211 L212
Binding residue (residue number reindexed from 1)	P1 V2 Q3 L4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Cellular Component

External links

PDB	RCSB:1y19, PDBe:1y19, PDBj:1y19
PDBsum	1y19
PubMed	15623515
UniProt	P26039\|TLN1_MOUSE Talin-1 (Gene Name=Tln1)

[Back to BioLiP]