Structure of PDB 1vr1 Chain H Binding Site BS02

Receptor Information
>1vr1 Chain H (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFAKHERFLCGASLISDRWVLTAAHCLLYPPWD
KNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIA
LMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAYYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vr1 The variable region-1 from tissue-type plasminogen activator confers specificity for plasminogen activator inhibitor-1 to thrombin by facilitating catalysis: release of a kinetic block by a heterologous protein surface loop
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K36 E38 L65 T74 R75 Y76 K81 I82
Binding residue
(residue number reindexed from 1)		K21 E23 L59 T68 R69 Y70 K76 I77
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1vr1, PDBe:1vr1, PDBj:1vr1
PDBsum1vr1
PubMed10543954
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]