Structure of PDB 1vq9 Chain H Binding Site BS02

Receptor Information

>1vq9 Chain H (length=160) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLI
VEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKD
GMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSC
RIDSSPAGNA

Ligand information

>1vq9 Chain 9 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc

...<<<<<<....<<<<<<<<......<<<<<...............>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vq9 Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	D8 E53
Binding residue (residue number reindexed from 1)	D8 E53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vq9, PDBe:1vq9, PDBj:1vq9
PDBsum	1vq9
PubMed	16285925
UniProt	P60617\|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]