Structure of PDB 1rio Chain H Binding Site BS02

Receptor Information
>1rio Chain H (length=61) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQI
ENKALRKLKYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rio Structure of a ternary transcription activation complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R387 T397 L398 R409 E410 R413
Binding residue
(residue number reindexed from 1)		R22 T32 L33 R44 E45 R48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rio, PDBe:1rio, PDBj:1rio
PDBsum1rio
PubMed14731393
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]