Structure of PDB 1n3f Chain H Binding Site BS02

Receptor Information
>1n3f Chain H (length=149) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRR
WFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQA
NLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n3f Flexible DNA Target Site Recognition by Divergent Homing Endonuclease Isoschizomers I-CreI and I-MsoI
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G719 D720 G721 S722 I724 Q726 K728 Q744 R770 N836 D837 S838 R841 K842
Binding residue
(residue number reindexed from 1)		G17 D18 G19 S20 I22 Q24 K26 Q42 R68 N134 D135 S136 R139 K140
Enzymatic activity
Catalytic site (original residue number in PDB) G719 D720
Catalytic site (residue number reindexed from 1) G17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n3f, PDBe:1n3f, PDBj:1n3f
PDBsum1n3f
PubMed12758074
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]