Structure of PDB 1kx5 Chain H Binding Site BS02

Receptor Information
>1kx5 Chain H (length=122) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTG
ISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
GELAKHAVSEGTKAVTKYTSAK
Ligand information
>1kx5 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kx5 Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
Resolution1.94 Å
Binding residue
(original residue number in PDB)
K20 K21 K25 R26 R27 K28 T29 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
K20 K21 K25 R26 R27 K28 T29 S52 S53 R83 S84 T85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1kx5, PDBe:1kx5, PDBj:1kx5
PDBsum1kx5
PubMed12079350
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]