Structure of PDB 1hbx Chain H Binding Site BS02

Receptor Information
>1hbx Chain H (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKP
NMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMSRNDYIHSG
LYSSFTLNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hbx The B-Box Dominates Sap-1/Srf Interactions in the Structure of the Ternary Complex
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Y56 R61 R64 Y67 K74 K79 F80 R138
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y65 K72 K77 F78 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hbx, PDBe:1hbx, PDBj:1hbx
PDBsum1hbx
PubMed11406578
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]