Structure of PDB 1hbt Chain H Binding Site BS02

Receptor Information
>1hbt Chain H (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hbt Crystal structure of a peptidyl pyridinium methyl ketone inhibitor with thrombin.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F34 Q38 L40 H57 Y60A W60D R73 T74 Y76 I82 Q151 D189 A190 E192 G193 S195 W215 G216
Binding residue
(residue number reindexed from 1)
F19 Q24 L26 H43 Y47 W50 R68 T69 Y71 I78 Q148 D191 A192 E194 G195 S197 W219 G220
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1hbt, PDBe:1hbt, PDBj:1hbt
PDBsum1hbt
PubMed7547884
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]