Structure of PDB 7uio Chain GA Binding Site BS02

Receptor Information
>7uio Chain GA (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q9 A10 R15 K18 K20 C21 K23 L49
Binding residue
(residue number reindexed from 1)		Q2 A3 R8 K11 K13 C14 K16 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uio, PDBe:7uio, PDBj:7uio
PDBsum7uio
PubMed36731470
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]