Structure of PDB 7ls1 Chain G2 Binding Site BS02

Receptor Information
>7ls1 Chain G2 (length=293) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKIYEGQVEVNGGEYNVESIDGQPGAFTCYLDAGLA
RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
QNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENP
VYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERA
Ligand information
>7ls1 Chain B2 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K8 F13 K14 V18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 R58 D59 I61 Q63 D72 M73 I74 Y79 G91 N94 Y95 R152 T155 N157 K158 H198 N203 Y207 Q222 F223 S224 Q225 Y226 Y253 K255 V261 K263 R265 W266 N267 R268 K270 M271 L273 K276 K284
Binding residue
(residue number reindexed from 1)		K7 F12 K13 V17 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 R57 D58 I60 Q62 D71 M72 I73 Y78 G90 N93 Y94 R151 T154 N156 K157 H197 N202 Y206 Q221 F222 S223 Q224 Y225 Y252 K254 V260 K262 R264 W265 N266 R267 K269 M270 L272 K275 K283
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum7ls1
PubMed34815424
UniProtP47962|RL5_MOUSE Large ribosomal subunit protein uL18 (Gene Name=Rpl5)

[Back to BioLiP]