Structure of PDB 9b3p Chain G Binding Site BS02

Receptor Information
>9b3p Chain G (length=102) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVL
ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKS
LI
Ligand information
>9b3p Chain J (length=128) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacg
cacgtacgcgctgtcccccgcgttttaaccgccaaggggattactcccta
gtctccaggcacgtgtcagatatataca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b3p Structural and Biochemical Characterization of the Nucleosome Containing Variants H3.3 and H2A.Z
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R31 K37 R45 V46 G47 V78 K79 R80
Binding residue
(residue number reindexed from 1)		R15 K21 R29 V30 G31 V62 K63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9b3p, PDBe:9b3p, PDBj:9b3p
PDBsum9b3p
PubMed38920622
UniProtP0C0S6|H2AZ_MOUSE Histone H2A.Z (Gene Name=H2az1)

[Back to BioLiP]