Structure of PDB 8wh5 Chain G Binding Site BS02

Receptor Information
>8wh5 Chain G (length=99) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELA
GNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLL
Ligand information
>8wh5 Chain J (length=133) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgacacgtgcctggagactagggagtaatccccttgggcggttaaac
gcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacga
ccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wh5 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
Resolution3.58 Å
Binding residue
(original residue number in PDB)		R30 K36 R43 V44 G45 K76 T77
Binding residue
(residue number reindexed from 1)		R13 K19 R26 V27 G28 K59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0009294 DNA-mediated transformation
GO:0009611 response to wounding
GO:0009617 response to bacterium
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wh5, PDBe:8wh5, PDBj:8wh5
PDBsum8wh5
PubMed38413824
UniProtQ9LD28|H2A6_ARATH Histone H2A.6 (Gene Name=RAT5)

[Back to BioLiP]