Structure of PDB 8u3b Chain G Binding Site BS02

Receptor Information
>8u3b Chain G (length=66) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKL
KSRVEAAVWVHQERIF
Ligand information
>8u3b Chain 2 (length=69) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgctgccgcgaattccgtttcagggtacgcctgataatttgcattttaa
ataccatttattggttact
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u3b Structural basis for transcription activation by the nitrate-responsive regulator NarL.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		N173 K188 K192 R203
Binding residue
(residue number reindexed from 1)		N23 K38 K42 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8u3b, PDBe:8u3b, PDBj:8u3b
PDBsum8u3b
PubMed38197271
UniProtP0AF28|NARL_ECOLI Nitrate/nitrite response regulator protein NarL (Gene Name=narL)

[Back to BioLiP]