Structure of PDB 8t9f Chain G Binding Site BS02

Receptor Information
>8t9f Chain G (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK
SLI
Ligand information
>8t9f Chain J (length=122) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcctggagactagggagtaatccccttggcggttaaaacgcgggggagaa
tccgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcg
gcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t9f Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R31 K37 R45 V46 R80
Binding residue
(residue number reindexed from 1)
R16 K22 R30 V31 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8t9f, PDBe:8t9f, PDBj:8t9f
PDBsum8t9f
PubMed37595555
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1)

[Back to BioLiP]