Structure of PDB 8rkg Chain G Binding Site BS02

Receptor Information
>8rkg Chain G (length=170) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFN
LENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNSTHATVLIPFFG
GVLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRSTLKGDRNDVL
VLTFIYYGKTVPMLISLVCS
Ligand information
>8rkg Chain S (length=28) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSVVTCTKDSMTVRIPRTLSGFDDEIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
S165 F166 W167 R186 S193 S194 L199
Binding residue
(residue number reindexed from 1)
S1 F2 W3 R22 S29 S30 L35
Enzymatic activity
Enzyme Commision number ?
External links