Structure of PDB 8pp6 Chain G Binding Site BS02

Receptor Information

>8pp6 Chain G (length=109) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE
VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNI
QAVLLPKKT

Ligand information

>8pp6 Chain J (length=156) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aatacacaggatgtatatatctgacacgtgcctggagattagggagtaat
ccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcgg
tgctagagctgtctacgaccaattgagcggcctcggcaccgggattctcc
aggtcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pp6 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
Resolution	3.18 Å
Binding residue (original residue number in PDB)	R28 R41 V42 K74 R76
Binding residue (residue number reindexed from 1)	R18 R31 V32 K64 R66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0007526	larval somatic muscle development
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005700	polytene chromosome
GO:0005704	polytene chromosome band

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pp6, PDBe:8pp6, PDBj:8pp6
PDBsum	8pp6
PubMed	38528151
UniProt	P84051\|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]