Structure of PDB 8pn4 Chain G Binding Site BS02

Receptor Information
>8pn4 Chain G (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQN
RRTKWKRQTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pn4 transcription factor BARHL2 bound to DNA sequences
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R233 R236 Y256 R262 Q281 R284
Binding residue
(residue number reindexed from 1)		R1 R4 Y24 R30 Q49 R52
External links
PDB RCSB:8pn4, PDBe:8pn4, PDBj:8pn4
PDBsum8pn4
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]