Structure of PDB 8pmc Chain G Binding Site BS02

Receptor Information
>8pmc Chain G (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pmc transcription factor BARHL2 bound to DNA sequences
Resolution1.85 Å
Binding residue
(original residue number in PDB)		R233 R236 Y256 R262 Q281 R284 K288
Binding residue
(residue number reindexed from 1)		R2 R5 Y25 R31 Q50 R53 K57
External links
PDB RCSB:8pmc, PDBe:8pmc, PDBj:8pmc
PDBsum8pmc
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]