Structure of PDB 8pm7 Chain G Binding Site BS02

Receptor Information
>8pm7 Chain G (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pm7 transcription factor BARHL2 bound to DNA sequences
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R233 R236 Y256 R262 K277 Q281 R284
Binding residue
(residue number reindexed from 1)		R2 R5 Y25 R31 K46 Q50 R53
External links
PDB RCSB:8pm7, PDBe:8pm7, PDBj:8pm7
PDBsum8pm7
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]