Structure of PDB 8pkl Chain G Binding Site BS02

Receptor Information
>8pkl Chain G (length=153) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AHY
Ligand information
>8pkl Chain X (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcauccguagcucagcuggauagaguacucggcuacgaaccgagcggucg
gagguucgaauccucccggaugcacca
<<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pkl Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		S77 Q86 M144
Binding residue
(residue number reindexed from 1)		S76 Q85 M143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pkl, PDBe:8pkl, PDBj:8pkl
PDBsum8pkl
PubMed38409277
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]