Structure of PDB 8h9h Chain G Binding Site BS02

Receptor Information
>8h9h Chain G (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h9h ZBTB7A regulates primed-to-naive transition of pluripotent stem cells via recognition of the PNT-associated sequence by zinc fingers 1-2 and recognition of gamma-globin -200 gene element by zinc fingers 1-4.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K389 Q392 K396 R399 H400 R421 Y451
Binding residue
(residue number reindexed from 1)		K10 Q13 K17 R20 H21 R42 Y72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8h9h, PDBe:8h9h, PDBj:8h9h
PDBsum8h9h
PubMed37013936
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]