Structure of PDB 8fmw Chain G Binding Site BS02

Receptor Information
>8fmw Chain G (length=157) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRKNKKIKKKVFVDTRYNSRIVAKFANRMMYDGKKSISESILYSSIDLL
ADKLEESDKMAVFYKALDNIKPLVEVRSRRVGGATYQVPVEVREERREAL
AMKWIIFAARKSSGRSMKEKLSNELLNAYNSTGAAFKKKEDTHRMAEANK
AFTHYRW
Ligand information
>8fmw Chain X (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgcuguagcucaguugguagagcauaggacugaaaauccuugugucag
gaguucgauucuccucggcgacacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>.>....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		T85 Q87 R144 M145
Binding residue
(residue number reindexed from 1)		T85 Q87 R144 M145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum8fmw
PubMed37907464
UniProtO51347|RS7_BORBU Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]