Structure of PDB 8ev3 Chain G Binding Site BS02

Receptor Information

>8ev3 Chain G (length=164) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVAN
GKVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKK
MGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANF
SAKYDESRRKWGGG

Ligand information

>8ev3 Chain 2 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacugcgccuuuggguucuaccaaaggcaugccuguuugagugucauu

..........................................<<<<<<<<
.....>>>>.....<.<<<.......>........>>>..>...>>>...
.<<...>><<<<<<<<......>>>>>>>>....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	K181 N182 R185
Binding residue (residue number reindexed from 1)	K109 N110 R113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum	8ev3
PubMed	36423630
UniProt	O13672\|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]