Structure of PDB 8euy Chain G Binding Site BS02

Receptor Information

>8euy Chain G (length=164) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVAN
GKVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKK
MGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANF
SAKYDESRRKWGGG

Ligand information

>8euy Chain 2 (length=130) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugaaucaucgaaucuuugaacgcacug
cgccuuaaggcaugccuguuugagugucau

.........................................<<<<<<<..
....>>>>.....<.<<<..........>>>..>...>>>....<<<.>>
><<<<..>>>>...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	K84 K181 N182 R185
Binding residue (residue number reindexed from 1)	K16 K109 N110 R113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8euy, PDBe:8euy, PDBj:8euy
PDBsum	8euy
PubMed	36423630
UniProt	O13672\|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]