Structure of PDB 8byx Chain G Binding Site BS02

Receptor Information
>8byx Chain G (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8byx HOXB13-homodimer bound to DNA
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K219 R220 P222 F240 Q265 R268 K272
Binding residue
(residue number reindexed from 1)		K3 R4 P6 F24 Q49 R52 K56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8byx, PDBe:8byx, PDBj:8byx
PDBsum8byx
PubMed
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]