Structure of PDB 7y8w Chain G Binding Site BS02

Receptor Information
>7y8w Chain G (length=86) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Ligand information
>7y8w Chain L (length=24) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FMQHANVATDQVVMKSVECQTEPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y8w Interaction between DLC-1 and SAO-1 facilitates CED-4 translocation during apoptosis in the Caenorhabditis elegans germline.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R60 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 F73 Y75 Y77
Binding residue
(residue number reindexed from 1)		R57 N58 F59 G60 S61 Y62 V63 T64 H65 E66 T67 F70 Y72 Y74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0006915 apoptotic process
GO:0007017 microtubule-based process
GO:0030473 nuclear migration along microtubule
GO:0051301 cell division
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y8w, PDBe:7y8w, PDBj:7y8w
PDBsum7y8w
PubMed36323675
UniProtQ22799|DYL1_CAEEL Dynein light chain 1, cytoplasmic (Gene Name=dlc-1)

[Back to BioLiP]