Structure of PDB 7xyg Chain G Binding Site BS02

Receptor Information
>7xyg Chain G (length=105) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA
VLLPK
Ligand information
>7xyg Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xyg Cryo-EM structure of Fft3-nucleosome complex with Fft3 bound to SHL+3 position of the nucleosome (Class II Fft3-nucleosome complex)
Resolution4.2 Å
Binding residue
(original residue number in PDB)
R35 R42 V43 K75 T76 R77 K118
Binding residue
(residue number reindexed from 1)
R22 R29 V30 K62 T63 R64 K105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7xyg, PDBe:7xyg, PDBj:7xyg
PDBsum7xyg
PubMed
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]