Structure of PDB 7x76 Chain G Binding Site BS02

Receptor Information
>7x76 Chain G (length=131) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTL
QSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVE
KWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
Ligand information
>7x76 Chain P (length=84) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcgacccggcgcccgctacggagtcaactacgggtagggggtatcgggc
aacgcggcactgaacaccgttgtcatgtgccttg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x76 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		R11 E73
Binding residue
(residue number reindexed from 1)		R6 E68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x76, PDBe:7x76, PDBj:7x76
PDBsum7x76
PubMed35871291
UniProtQ9L2H5

[Back to BioLiP]