Structure of PDB 7x5a Chain G Binding Site BS02

Receptor Information
>7x5a Chain G (length=135) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPSVGEPVTLHTH
LVVREDAHLLYGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVR
CVQAQDTSTLVKIPGVGKKTAERLLVELKDRFKAW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x5a Cryo-EM structure of the RuvAB-Holliday junction intermediate complex from Pseudomonas aeruginosa.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		P114 G115 G117
Binding residue
(residue number reindexed from 1)		P114 G115 G117
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
GO:0009378 four-way junction helicase activity
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x5a, PDBe:7x5a, PDBj:7x5a
PDBsum7x5a
PubMed37025142
UniProtQ51425|RUVA_PSEAE Holliday junction branch migration complex subunit RuvA (Gene Name=ruvA)

[Back to BioLiP]