Structure of PDB 7ud5 Chain G Binding Site BS02

Receptor Information
>7ud5 Chain G (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQ
SVLLP
Ligand information
>7ud5 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ud5 Multistate structures of the MLL1-WRAD complex bound to H2B-ubiquitinated nucleosome.
Resolution4.25 Å
Binding residue
(original residue number in PDB)		K13 A14 R20 R29 R42
Binding residue
(residue number reindexed from 1)		K1 A2 R8 R17 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ud5, PDBe:7ud5, PDBj:7ud5
PDBsum7ud5
PubMed36095189
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]