Structure of PDB 7rcc Chain G Binding Site BS02

Receptor Information
>7rcc Chain G (length=281) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRESINPWILTGFADAEGSFGLSILNRRYHTRLSFAIVLHNKDKSILENI
QSTWKVGIITNDGDRYVRLRVTRFEDLKVIIDHFEKYPLVTQKLGDYKLF
KQAFSVMENKEHLKENGIKELVRIKAKMNWGLNDELKKAFPENISKERPL
INKNIPNFKWLAGFTSGDGSFFVRLRRVRVQLVFEISQHIRDKNLMNSLI
TYLGCGHIYEGNKSERSWLQFRVEKFSDINDKIIPVFQENTLIGVKLEDF
EDWCKVAKLIEEKKHLLDEIKKIKLNMNKGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rcc Characterization of the stepwise engineering and optimization of a retargeted DNA binding protein and gene-editing meganuclease
Resolution2.45 Å
Binding residue
(original residue number in PDB)		A21 E22 G23 S24 S28 R42 V48 L49 H50 R75 Y76 R80 K103 N139 W140 N143 R186 H223 Y225 W234 Q236 R238 E240 K241 F242
Binding residue
(residue number reindexed from 1)		A16 E17 G18 S19 S23 R32 V38 L39 H40 R65 Y66 R70 K93 N129 W130 N133 R176 H207 Y209 W218 Q220 R222 E224 K225 F226
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 08:22:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7rcc', asym_id = 'G', bs = 'BS02', title = 'Characterization of the stepwise engineering and...DNA binding protein and gene-editing meganuclease'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7rcc', asym_id='G', bs='BS02', title='Characterization of the stepwise engineering and...DNA binding protein and gene-editing meganuclease')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '7rcc', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='7rcc', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>