Structure of PDB 7qiy Chain G Binding Site BS02

Receptor Information
>7qiy Chain G (length=126) Species: 4081 (Solanum lycopersicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKFSYRGVDLDSLLDMSTDELVKLYPARPRRRFQRGLKRKPMALIKKLRK
AKREAPQGEKPEVVRTHLRNMIIVPEMIGSVIGIYNGKTFNQIEVKPEMI
SHYLAEFSISYKPVKHGRPGIGATHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qiy Cryo-EM structure and rRNA modification sites of a plant ribosome.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		T142 H143
Binding residue
(residue number reindexed from 1)		T124 H125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiy, PDBe:7qiy, PDBj:7qiy
PDBsum7qiy
PubMed35643637
UniProtA0A3Q7F5X2

[Back to BioLiP]