Structure of PDB 7q3o Chain G Binding Site BS02

Receptor Information
>7q3o Chain G (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKI
WFQNRRAKERK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q3o Structure of CDX1 bound to hydroxymethylated DNA
Resolution2.78 Å
Binding residue
(original residue number in PDB)		Y189 R190 V192 I213 K216 Q235 R238 R242
Binding residue
(residue number reindexed from 1)		Y7 R8 V10 I31 K34 Q53 R56 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7q3o, PDBe:7q3o, PDBj:7q3o
PDBsum7q3o
PubMed
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]