Structure of PDB 7jy9 Chain G Binding Site BS02

Receptor Information
>7jy9 Chain G (length=333) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIA
LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALT
PKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIG
VMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK
IAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQ
GKANATAWLKDNPETAKEIEKKVRELLLSNPNS
Ligand information
>7jy9 Chain U (length=42) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggtgtcgagtcagcctacccccccccattcaattaagcaagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jy9 Mechanism of strand exchange from RecA-DNA synaptic and D-loop structures.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
Q300 G301
Binding residue
(residue number reindexed from 1)
Q300 G301
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140297 DNA-binding transcription factor binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000725 recombinational repair
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0010212 response to ionizing radiation
GO:0019985 translesion synthesis
GO:0035825 homologous recombination
GO:0048870 cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0009355 DNA polymerase V complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7jy9, PDBe:7jy9, PDBj:7jy9
PDBsum7jy9
PubMed33057191
UniProtP0A7G6|RECA_ECOLI Protein RecA (Gene Name=recA)

[Back to BioLiP]